Lineage for d1euja_ (1euj A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59542Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 59555Protein EMAP II [50280] (1 species)
  7. 59556Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 59558Domain d1euja_: 1euj A: [25316]

Details for d1euja_

PDB Entry: 1euj (more details), 1.8 Å

PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases

SCOP Domain Sequences for d1euja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euja_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

SCOP Domain Coordinates for d1euja_:

Click to download the PDB-style file with coordinates for d1euja_.
(The format of our PDB-style files is described here.)

Timeline for d1euja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eujb_