Lineage for d4k66d_ (4k66 D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041440Domain d4k66d_: 4k66 D: [253155]
    Other proteins in same PDB: d4k66a1, d4k66a2, d4k66c1, d4k66c2, d4k66e1, d4k66e2, d4k66g1, d4k66g2
    automated match to d2ypgb_
    complexed with nag; mutant

Details for d4k66d_

PDB Entry: 4k66 (more details), 3.01 Å

PDB Description: structure of an airborne transmissible avian influenza h5 hemagglutinin mutant from the influenza virus a/indonesia/5/2005 complexed with avian receptor analog lsta
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4k66d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k66d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k66d_:

Click to download the PDB-style file with coordinates for d4k66d_.
(The format of our PDB-style files is described here.)

Timeline for d4k66d_: