SCOPe 2.07: Domain d1fl0a1: 1fl0 A:150-312

Lineage for d1fl0a1 (1fl0 A:150-312)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein EMAP II [50280] (1 species)
   domain of the p43 protein

7. Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)

8. Domain d1fl0a1: 1fl0 A:150-312 [25315]
   Other proteins in same PDB: d1fl0a2
   contains C-terminal His tag
   protein/RNA complex

Details for d1fl0a1

PDB Entry: 1fl0, 1.5 Å

PDB Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex

PDB Compounds: (A:) endothelial-monocyte activating polypeptide II

SCOPe Domain Sequences for d1fl0a1:

Sequence; same for both SEQRES and ATOM records:

>d1fl0a1 b.40.4.4 (A:150-312) EMAP II {Human (Homo sapiens) [TaxId: 9606]}
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

Timeline for d1fl0a1:

• d1fl0a1 first appeared (with stable ids) in SCOP 1.55, called d1fl0a_
  
• d1fl0a1 appears in SCOPe 2.06
  
• d1fl0a1 appears in the current release, SCOPe 2.08