Lineage for d1fl0a_ (1fl0 A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297568Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 297585Protein EMAP II [50280] (1 species)
    domain of the p43 protein
  7. 297586Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 297587Domain d1fl0a_: 1fl0 A: [25315]
    contains C-terminal His tag

Details for d1fl0a_

PDB Entry: 1fl0 (more details), 1.5 Å

PDB Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex

SCOP Domain Sequences for d1fl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl

SCOP Domain Coordinates for d1fl0a_:

Click to download the PDB-style file with coordinates for d1fl0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fl0a_: