![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) ![]() |
![]() | Family b.40.4.4: Myf domain [50277] (6 proteins) |
![]() | Protein EMAP II [50280] (1 species) domain of the p43 protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries) |
![]() | Domain d1fl0a_: 1fl0 A: [25315] contains C-terminal His tag |
PDB Entry: 1fl0 (more details), 1.5 Å
SCOP Domain Sequences for d1fl0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)} idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl
Timeline for d1fl0a_: