SCOP 1.63: Domain d1fl0a_: 1fl0 A:

Lineage for d1fl0a_ (1fl0 A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families)

5. Family b.40.4.4: Myf domain [50277] (4 proteins)

6. Protein EMAP II [50280] (1 species)
   domain of the p43 protein

7. Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)

8. Domain d1fl0a_: 1fl0 A: [25315]
   contains C-terminal His tag

Details for d1fl0a_

PDB Entry: 1fl0, 1.5 Å

PDB Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex

SCOP Domain Sequences for d1fl0a_:

Sequence; same for both SEQRES and ATOM records:

>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl

Timeline for d1fl0a_:

• d1fl0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fl0a_ appears in SCOP 1.61
  
• d1fl0a_ appears in SCOP 1.65
  
• d1fl0a_ appears in the current release, SCOPe 2.08, called d1fl0a1