Lineage for d1fl0a_ (1fl0 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166888Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 166902Protein EMAP II [50280] (1 species)
  7. 166903Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 166904Domain d1fl0a_: 1fl0 A: [25315]

Details for d1fl0a_

PDB Entry: 1fl0 (more details), 1.5 Å

PDB Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex

SCOP Domain Sequences for d1fl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl

SCOP Domain Coordinates for d1fl0a_:

Click to download the PDB-style file with coordinates for d1fl0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fl0a_: