SCOPe 2.05: Domain d4jymb_: 4jym B:

Lineage for d4jymb_ (4jym B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (8 PDB entries)

8. Domain d4jymb_: 4jym B: [253128]
   automated match to d1woma_
   complexed with kkn

Details for d4jymb_

PDB Entry: 4jym, 1.35 Å

PDB Description: crystal structure of kai2 in complex with 3-methyl-2h-furo[2,3- c]pyran-2-one

PDB Compounds: (B:) Hydrolase, alpha/beta fold family protein

SCOPe Domain Sequences for d4jymb_:

Sequence; same for both SEQRES and ATOM records:

>d4jymb_ c.69.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvveeahnvkvigsgeativlghgfgtdqsvwkhlvphlvddyrvvlydnmgagttnpdy
fdfdrysnlegysfdliailedlkiescifvghsvsamigvlaslnrpdlfskivmisas
pryvndvdyqggfeqedlnqlfeairsnykawclgfaplavggdmdsiavqefsrtlfnm
rpdialsvgqtifqsdmrqilpfvtvpchilqsvkdlavpvvvseylhanlgcesvvevi
psdghlpqlsspdsvipvilrhirndi

Timeline for d4jymb_:

• d4jymb_ first appeared in SCOPe 2.04
  
• d4jymb_ appears in SCOPe 2.06
  
• d4jymb_ appears in the current release, SCOPe 2.08