SCOPe 2.08: Domain d1b7yb3: 1b7y B:39-151

Lineage for d1b7yb3 (1b7y B:39-151)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.4: Myf domain [50277] (7 proteins)
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
identical sequence to Thermus aquaticus, TaxId: 271
Domain d1b7yb3: 1b7y B:39-151 [25312]
Other proteins in same PDB: d1b7ya_, d1b7yb1, d1b7yb2, d1b7yb4, d1b7yb5, d1b7yb6
protein/RNA complex; complexed with fya, mg

Details for d1b7yb3

PDB Entry: 1b7y (more details), 2.5 Å

PDB Description: phenylalanyl trna synthetase complexed with phenylalaninyl-adenylate

PDB Compounds: (B:) protein (phenylalanyl-tRNA synthetase)

SCOPe Domain Sequences for d1b7yb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7yb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d1b7yb3:

Click to download the PDB-style file with coordinates for d1b7yb3.
(The format of our PDB-style files is described here.)

Timeline for d1b7yb3: