SCOP 1.65: Domain d1pysb3: 1pys B:39-151

Lineage for d1pysb3 (1pys B:39-151)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.40: OB-fold [50198] (9 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)
Family b.40.4.4: Myf domain [50277] (6 proteins)
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries)
Domain d1pysb3: 1pys B:39-151 [25311]
Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb4, d1pysb5, d1pysb6
complexed with mg

Details for d1pysb3

PDB Entry: 1pys (more details), 2.9 Å

PDB Description: phenylalanyl-trna synthetase from thermus thermophilus

SCOP Domain Sequences for d1pysb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pysb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1pysb3:

Click to download the PDB-style file with coordinates for d1pysb3.
(The format of our PDB-style files is described here.)

Timeline for d1pysb3: