Lineage for d1pysb3 (1pys B:39-151)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.4: Myf domain [50277] (2 proteins) 
Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) Species Thermus thermophilus (Thermus aquaticus) [50279] (4 PDB entries) 
Domain d1pysb3: 1pys B:39-151 [25311]
Other proteins in same PDB: d1pysa_, d1pysb1, d1pysb2, d1pysb4, d1pysb5, d1pysb6
Details for d1pysb3
PDB Entry: 1pys (more details), 2.9 Å
PDB Description: phenylalanyl-trna synthetase from thermus thermophilus
SCOP Domain Sequences for d1pysb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pysb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
SCOP Domain Coordinates for d1pysb3:
Click to download the PDB-style file with coordinates for d1pysb3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pysb3:
- d1pysb3 appears in SCOP 1.57
- d1pysb3 appears in the current release, SCOPe 2.08
View in 3D
