Lineage for d1otcb_ (1otc B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14110Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 14111Species Oxytricha nova [TaxId:200597] [50276] (1 PDB entry)
  8. 14112Domain d1otcb_: 1otc B: [25310]
    Other proteins in same PDB: d1otca1, d1otca2, d1otca3

Details for d1otcb_

PDB Entry: 1otc (more details), 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna

SCOP Domain Sequences for d1otcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otcb_ b.40.4.3 (B:) Core domain of telomere end binding protein beta subunit {Oxytricha nova}
qqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeavn
efhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqerl
nptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdagi
vkasaskgdefsdfsfkegntatlkiadifvqe

SCOP Domain Coordinates for d1otcb_:

Click to download the PDB-style file with coordinates for d1otcb_.
(The format of our PDB-style files is described here.)

Timeline for d1otcb_: