Lineage for d4judx2 (4jud X:182-341)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470886Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2470929Protein Benzoylformate decarboxylase [52482] (1 species)
  7. 2470930Species Pseudomonas putida [TaxId:303] [52483] (43 PDB entries)
    Uniprot P20906
  8. 2470954Domain d4judx2: 4jud X:182-341 [253094]
    Other proteins in same PDB: d4judx1, d4judx3
    automated match to d1q6za1
    complexed with ca, gol, mg, tzd; mutant

Details for d4judx2

PDB Entry: 4jud (more details), 1.65 Å

PDB Description: Crystal Structure of the Ser26Thr mutant of Benzoylformate Decarboxylase from Pseudomonas putida
PDB Compounds: (X:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d4judx2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4judx2 c.31.1.3 (X:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

SCOPe Domain Coordinates for d4judx2:

Click to download the PDB-style file with coordinates for d4judx2.
(The format of our PDB-style files is described here.)

Timeline for d4judx2: