Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Benzoylformate decarboxylase [52482] (1 species) |
Species Pseudomonas putida [TaxId:303] [52483] (43 PDB entries) Uniprot P20906 |
Domain d4jucd2: 4juc D:182-341 [253091] Other proteins in same PDB: d4juca1, d4juca3, d4jucb1, d4jucb3, d4jucc1, d4jucc3, d4jucd1, d4jucd3 automated match to d1q6za1 complexed with ca, gol, tpp; mutant |
PDB Entry: 4juc (more details), 2.3 Å
SCOPe Domain Sequences for d4jucd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jucd2 c.31.1.3 (D:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d4jucd2: