SCOP 1.71: Domain d1otca2: 1otc A:205-328

Lineage for d1otca2 (1otc A:205-328)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Telomere end binding protein alpha subunit [50273] (1 species)
   duplication: consists of three domains of this fold

7. Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries)

8. Domain d1otca2: 1otc A:205-328 [25308]
   Other proteins in same PDB: d1otcb_

Details for d1otca2

PDB Entry: 1otc, 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna

SCOP Domain Sequences for d1otca2:

Sequence; same for both SEQRES and ATOM records:

>d1otca2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

Timeline for d1otca2:

• d1otca2 first appeared (with stable ids) in SCOP 1.55
  
• d1otca2 appears in SCOP 1.69
  
• d1otca2 appears in SCOP 1.73
  
• d1otca2 appears in the current release, SCOPe 2.08