Lineage for d1otca2 (1otc A:205-328)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229167Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (8 proteins)
    barrel, closed; n=5, S=10
  6. 229230Protein Telomere end binding protein alpha subunit [50273] (1 species)
    duplication: consists of three domains of this fold
  7. 229231Species Oxytricha nova [TaxId:200597] [50274] (4 PDB entries)
  8. 229245Domain d1otca2: 1otc A:205-328 [25308]
    Other proteins in same PDB: d1otcb_

Details for d1otca2

PDB Entry: 1otc (more details), 2.8 Å

PDB Description: the o. nova telomere end binding protein complexed with single strand dna

SCOP Domain Sequences for d1otca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otca2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova}
vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph
vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl
kknv

SCOP Domain Coordinates for d1otca2:

Click to download the PDB-style file with coordinates for d1otca2.
(The format of our PDB-style files is described here.)

Timeline for d1otca2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1otcb_