Lineage for d4jt0o_ (4jt0 O:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1676715Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1676731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (66 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1677104Domain d4jt0o_: 4jt0 O: [253019]
    Other proteins in same PDB: d4jt0b_, d4jt0c_, d4jt0f_, d4jt0g_, d4jt0h_, d4jt0p_, d4jt0q_, d4jt0t_, d4jt0u_, d4jt0v_
    automated match to d1rypb_
    complexed with 0l1, mes

Details for d4jt0o_

PDB Entry: 4jt0 (more details), 3.1 Å

PDB Description: Yeast 20S proteasome in complex with the dimerized linear mimetic of TMC-95A - yCP:4a
PDB Compounds: (O:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4jt0o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jt0o_ d.153.1.4 (O:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d4jt0o_:

Click to download the PDB-style file with coordinates for d4jt0o_.
(The format of our PDB-style files is described here.)

Timeline for d4jt0o_: