Lineage for d4jm2f2 (4jm2 F:98-175)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753466Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2753476Protein CD4 C2-set domains [49149] (2 species)
  7. 2753477Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries)
  8. 2753501Domain d4jm2f2: 4jm2 F:98-175 [252986]
    Other proteins in same PDB: d4jm2a_, d4jm2b1, d4jm2b2, d4jm2c1, d4jm2c2, d4jm2e_, d4jm2f1
    automated match to d3o2da2
    complexed with nag, pg4

Details for d4jm2f2

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
PDB Compounds: (F:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4jm2f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jm2f2 b.1.1.3 (F:98-175) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}
fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw
tctvlqnqkkvefkidiv

SCOPe Domain Coordinates for d4jm2f2:

Click to download the PDB-style file with coordinates for d4jm2f2.
(The format of our PDB-style files is described here.)

Timeline for d4jm2f2: