SCOPe 2.04: Domain d4jm2b2: 4jm2 B:107-214

Lineage for d4jm2b2 (4jm2 B:107-214)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d4jm2b2: 4jm2 B:107-214 [252981]
Other proteins in same PDB: d4jm2b1, d4jm2c1, d4jm2e_, d4jm2f1, d4jm2f2
automated match to d1dn0a2
complexed with nag, pg4

Details for d4jm2b2

PDB Entry: 4jm2 (more details), 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab

PDB Compounds: (B:) PGT 135 Light Chain

SCOPe Domain Sequences for d4jm2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jm2b2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4jm2b2:

Click to download the PDB-style file with coordinates for d4jm2b2.
(The format of our PDB-style files is described here.)

Timeline for d4jm2b2: