Lineage for d4jk4b1 (4jk4 B:2-195)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1748371Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 1748372Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 1748706Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 1748707Protein automated matches [254493] (5 species)
    not a true protein
  7. 1748708Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries)
  8. 1748718Domain d4jk4b1: 4jk4 B:2-195 [252963]
    automated match to d3jrya1
    complexed with 1pe, ca, diu, peg, pge

Details for d4jk4b1

PDB Entry: 4jk4 (more details), 2.65 Å

PDB Description: crystal structure of bovine serum albumin in complex with 3,5- diiodosalicylic acid
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4jk4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jk4b1 a.126.1.0 (B:2-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag
cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt
lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki
etmrekvltssarq

SCOPe Domain Coordinates for d4jk4b1:

Click to download the PDB-style file with coordinates for d4jk4b1.
(The format of our PDB-style files is described here.)

Timeline for d4jk4b1: