SCOPe 2.06: Domain d4jgha2: 4jgh A:149-198

Lineage for d4jgha2 (4jgh A:149-198)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.271: SOCS box-like [158234] (1 superfamily)
   helix-loop-helix motif with orthogonally packed helices

4. Superfamily a.271.1: SOCS box-like [158235] (2 families)

5. Family a.271.1.0: automated matches [254330] (1 protein)
   not a true family

6. Protein automated matches [254753] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256332] (1 PDB entry)

8. Domain d4jgha2: 4jgh A:149-198 [252932]
   Other proteins in same PDB: d4jgha1, d4jgha3, d4jghb_, d4jghc_, d4jghd1, d4jghd2
   automated match to d2c9wa1

Details for d4jgha2

PDB Entry: 4jgh, 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5

PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d4jgha2:

Sequence; same for both SEQRES and ATOM records:

>d4jgha2 a.271.1.0 (A:149-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

Timeline for d4jgha2:

• d4jgha2 first appeared in SCOPe 2.04
  
• d4jgha2 appears in SCOPe 2.05
  
• d4jgha2 appears in SCOPe 2.07
  
• d4jgha2 appears in the current release, SCOPe 2.08