SCOPe 2.04: Domain d4jgha1: 4jgh A:26-134

Lineage for d4jgha1 (4jgh A:26-134)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (11 PDB entries)

8. Domain d4jgha1: 4jgh A:26-134 [252931]
   Other proteins in same PDB: d4jgha2, d4jghb_, d4jghc_, d4jghd_
   automated match to d2c9wa2

Details for d4jgha1

PDB Entry: 4jgh, 3 Å

PDB Description: Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5

PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d4jgha1:

Sequence; same for both SEQRES and ATOM records:

>d4jgha1 d.93.1.1 (A:26-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmdpefqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltis
vktsagptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

Timeline for d4jgha1:

• d4jgha1 is new in SCOPe 2.04-stable
  
• d4jgha1 appears in SCOPe 2.05
  
• d4jgha1 appears in the current release, SCOPe 2.08