Lineage for d4jevb1 (4jev B:6-405)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505487Species Salmonella typhimurium [TaxId:99287] [255544] (9 PDB entries)
  8. 2505499Domain d4jevb1: 4jev B:6-405 [252907]
    Other proteins in same PDB: d4jeva2, d4jevb2
    automated match to d4adbb_
    complexed with act, na, pxg

Details for d4jevb1

PDB Entry: 4jev (more details), 1.67 Å

PDB Description: N-acetylornithine aminotransferase from S. typhimurium complexed with gabaculine
PDB Compounds: (B:) Acetylornithine/succinyldiaminopimelate aminotransferase

SCOPe Domain Sequences for d4jevb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jevb1 c.67.1.0 (B:6-405) automated matches {Salmonella typhimurium [TaxId: 99287]}
taitratfdevilpvyapadfipvkgkgsrvwdqqgkeyidfaggiavtalghchpalve
alksqgetlwhtsnvftnepalrlgrklidatfaervlfmnsgteanetafklarhyacv
rhspfktkiiafhnafhgrslftvsvggqpkysdgfgpkpadiihvpfndlhavkavmdd
htcavvvepiqgeggvqaatpeflkglrdlcdehqallvfdevqcgmgrtgdlfaymhyg
vtpdiltsakalgggfpvsamlttqeiasafhvgshgstyggnplacavagatfdiintp
evlqgihtkrqqfvqhlqaideqfdifsdirgmglligaelkpkykgrardflyagaeag
vmvlnagadvmrfapslvveeadihegmqrfaqavgkvva

SCOPe Domain Coordinates for d4jevb1:

Click to download the PDB-style file with coordinates for d4jevb1.
(The format of our PDB-style files is described here.)

Timeline for d4jevb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jevb2