SCOPe 2.04: Domain d4jcma3: 4jcm A:487-568

Lineage for d4jcma3 (4jcm A:487-568)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Bacillus clarkii [TaxId:79879] [256323] (1 PDB entry)

8. Domain d4jcma3: 4jcm A:487-568 [252888]
   Other proteins in same PDB: d4jcma1, d4jcma2, d4jcma4
   automated match to d1cyga1
   complexed with ca, cl, edo, gol, na, so4

Details for d4jcma3

PDB Entry: 4jcm, 1.65 Å

PDB Description: Crystal structure of Gamma-CGTASE from Alkalophilic bacillus clarkii at 1.65 Angstrom resolution

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d4jcma3:

Sequence; same for both SEQRES and ATOM records:

>d4jcma3 b.1.18.0 (A:487-568) automated matches {Bacillus clarkii [TaxId: 79879]}
gsapvigqvgppmgkpgdavkisgsgfgsepgtvyfrdtkidvltwddetivitlpetlg
gkaqisvtnsdgvtsngydfql

Timeline for d4jcma3:

• d4jcma3 is new in SCOPe 2.04-stable
  
• d4jcma3 appears in SCOPe 2.05
  
• d4jcma3 appears in the current release, SCOPe 2.08