SCOPe 2.06: Domain d4jcma2: 4jcm A:397-486

Lineage for d4jcma2 (4jcm A:397-486)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Bacillus clarkii [TaxId:79879] [256321] (1 PDB entry)

8. Domain d4jcma2: 4jcm A:397-486 [252887]
   Other proteins in same PDB: d4jcma1, d4jcma3, d4jcma4
   automated match to d1cyga3
   complexed with ca, cl, edo, gol, na, so4

Details for d4jcma2

PDB Entry: 4jcm, 1.65 Å

PDB Description: Crystal structure of Gamma-CGTASE from Alkalophilic bacillus clarkii at 1.65 Angstrom resolution

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d4jcma2:

Sequence; same for both SEQRES and ATOM records:

>d4jcma2 b.71.1.0 (A:397-486) automated matches {Bacillus clarkii [TaxId: 79879]}
gstkerwinddvliyersfngdyllvainknvnqaytisglltempaqvyhdvldslldg
qslavkengtvdsfllgpgevsvwqhises

Timeline for d4jcma2:

• d4jcma2 first appeared in SCOPe 2.04
  
• d4jcma2 appears in SCOPe 2.05
  
• d4jcma2 appears in SCOPe 2.07
  
• d4jcma2 appears in the current release, SCOPe 2.08