Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Bacillus clarkii [TaxId:79879] [256321] (1 PDB entry) |
Domain d4jcma2: 4jcm A:397-486 [252887] Other proteins in same PDB: d4jcma1, d4jcma3, d4jcma4 automated match to d1cyga3 complexed with ca, cl, edo, gol, na, so4 |
PDB Entry: 4jcm (more details), 1.65 Å
SCOPe Domain Sequences for d4jcma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcma2 b.71.1.0 (A:397-486) automated matches {Bacillus clarkii [TaxId: 79879]} gstkerwinddvliyersfngdyllvainknvnqaytisglltempaqvyhdvldslldg qslavkengtvdsfllgpgevsvwqhises
Timeline for d4jcma2: