Lineage for d4jcla3 (4jcl A:498-584)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039762Species Paenibacillus macerans [TaxId:44252] [256324] (2 PDB entries)
  8. 2039763Domain d4jcla3: 4jcl A:498-584 [252884]
    Other proteins in same PDB: d4jcla1, d4jcla2, d4jcla4
    automated match to d3cgta1
    complexed with ca, cl, edo, gol, peg, pge

Details for d4jcla3

PDB Entry: 4jcl (more details), 1.7 Å

PDB Description: Crystal structure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d4jcla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcla3 b.1.18.0 (A:498-584) automated matches {Paenibacillus macerans [TaxId: 44252]}
tspaignvgptmgqpgnivtidgrgfggtagtvyfgttavtgsgivswedtqikavipkv
aagktgvsvktssgtasntfksfnvlt

SCOPe Domain Coordinates for d4jcla3:

Click to download the PDB-style file with coordinates for d4jcla3.
(The format of our PDB-style files is described here.)

Timeline for d4jcla3: