Lineage for d4jcla2 (4jcl A:408-497)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. 1556303Species Paenibacillus macerans [TaxId:44252] [256322] (2 PDB entries)
  8. 1556304Domain d4jcla2: 4jcl A:408-497 [252883]
    Other proteins in same PDB: d4jcla1, d4jcla3, d4jcla4
    automated match to d3cgta3
    complexed with ca, cl, edo, gol, peg, pge

Details for d4jcla2

PDB Entry: 4jcl (more details), 1.7 Å

PDB Description: Crystal structure of Alpha-CGT from Paenibacillus macerans at 1.7 Angstrom resolution
PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOPe Domain Sequences for d4jcla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcla2 b.71.1.0 (A:408-497) automated matches {Paenibacillus macerans [TaxId: 44252]}
gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng
nsitvgsggavtnftlaaggtavwqytape

SCOPe Domain Coordinates for d4jcla2:

Click to download the PDB-style file with coordinates for d4jcla2.
(The format of our PDB-style files is described here.)

Timeline for d4jcla2: