Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (27 species) not a true protein |
Species Paenibacillus macerans [TaxId:44252] [256322] (2 PDB entries) |
Domain d4jcla2: 4jcl A:408-497 [252883] Other proteins in same PDB: d4jcla1, d4jcla3, d4jcla4 automated match to d3cgta3 complexed with ca, cl, edo, gol, peg, pge |
PDB Entry: 4jcl (more details), 1.7 Å
SCOPe Domain Sequences for d4jcla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcla2 b.71.1.0 (A:408-497) automated matches {Paenibacillus macerans [TaxId: 44252]} gttterwvnndvliierkfgssaalvainrnssaaypisgllsslpagtysdvlngllng nsitvgsggavtnftlaaggtavwqytape
Timeline for d4jcla2: