Lineage for d4jbsb4 (4jbs B:638-961)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745667Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1745668Protein automated matches [190220] (12 species)
    not a true protein
  7. 1745698Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries)
  8. 1745733Domain d4jbsb4: 4jbs B:638-961 [252879]
    Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa3, d4jbsb1, d4jbsb2, d4jbsb3
    automated match to d2yd0a4
    complexed with imd, nag, p52, zn

Details for d4jbsb4

PDB Entry: 4jbs (more details), 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jbsb4 a.118.1.0 (B:638-961) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspall
eglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallkl
acdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsms
saeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvr
enwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvlet
itknikwleknlptlrtwlmvntr

SCOPe Domain Coordinates for d4jbsb4:

Click to download the PDB-style file with coordinates for d4jbsb4.
(The format of our PDB-style files is described here.)

Timeline for d4jbsb4: