Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (16 PDB entries) |
Domain d4jbsa3: 4jbs A:547-637 [252874] Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa4, d4jbsa5, d4jbsb1, d4jbsb2, d4jbsb4, d4jbsb5 automated match to d2yd0a3 complexed with imd, nag, p52, zn |
PDB Entry: 4jbs (more details), 2.79 Å
SCOPe Domain Sequences for d4jbsa3:
Sequence, based on SEQRES records: (download)
>d4jbsa3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk sktdtldlpektswvkfnvdsngyyivhyeg
>d4jbsa3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]} ipllvvkqdgcslrlqqerflqgqerylwhipltystsssnvihrhilksktdtldlpek tswvkfnvdsngyyivhyeg
Timeline for d4jbsa3: