SCOPe 2.05: Domain d4jbsa3: 4jbs A:547-637

Lineage for d4jbsa3 (4jbs A:547-637)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries)

8. Domain d4jbsa3: 4jbs A:547-637 [252874]
   Other proteins in same PDB: d4jbsa1, d4jbsa2, d4jbsa4, d4jbsb1, d4jbsb2, d4jbsb4
   automated match to d2yd0a3
   complexed with imd, nag, p52, zn

Details for d4jbsa3

PDB Entry: 4jbs, 2.79 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2 in complex with phosphinic pseudotripeptide inhibitor.

PDB Compounds: (A:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d4jbsa3:

Sequence, based on SEQRES records:

>d4jbsa3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg

Sequence, based on observed residues (ATOM records):

>d4jbsa3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgqerylwhipltystsssnvihrhilksktdtldlpek
tswvkfnvdsngyyivhyeg

Timeline for d4jbsa3:

• d4jbsa3 first appeared in SCOPe 2.04
  
• d4jbsa3 appears in SCOPe 2.06
  
• d4jbsa3 appears in the current release, SCOPe 2.08