Lineage for d4javb1 (4jav B:236-320)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995434Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1995474Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 1995492Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 1995493Protein automated matches [227713] (2 species)
    not a true protein
  7. 1995497Species Thermotoga maritima [TaxId:243274] [227714] (4 PDB entries)
  8. 1995500Domain d4javb1: 4jav B:236-320 [252856]
    Other proteins in same PDB: d4java2, d4javb2, d4javc_, d4javd_
    automated match to d2c2aa1
    complexed with adp, cl, mg, so4; mutant

Details for d4javb1

PDB Entry: 4jav (more details), 3.1 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853wt and RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (B:) Histidine kinase

SCOPe Domain Sequences for d4javb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4javb1 a.30.2.0 (B:236-320) automated matches {Thermotoga maritima [TaxId: 243274]}
teskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkeflevi
idqsnhlenllnelldfsrlerksl

SCOPe Domain Coordinates for d4javb1:

Click to download the PDB-style file with coordinates for d4javb1.
(The format of our PDB-style files is described here.)

Timeline for d4javb1: