Class a: All alpha proteins [46456] (289 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) |
Family a.30.2.0: automated matches [227712] (1 protein) not a true family |
Protein automated matches [227713] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [227714] (4 PDB entries) |
Domain d4javb1: 4jav B:236-320 [252856] Other proteins in same PDB: d4java2, d4javb2, d4javc_, d4javd_ automated match to d2c2aa1 complexed with adp, cl, mg, so4; mutant |
PDB Entry: 4jav (more details), 3.1 Å
SCOPe Domain Sequences for d4javb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4javb1 a.30.2.0 (B:236-320) automated matches {Thermotoga maritima [TaxId: 243274]} teskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkeflevi idqsnhlenllnelldfsrlerksl
Timeline for d4javb1:
View in 3D Domains from other chains: (mouse over for more information) d4java1, d4java2, d4javc_, d4javd_ |