Lineage for d4jasb_ (4jas B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1587002Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1587003Protein automated matches [190131] (54 species)
    not a true protein
  7. 1587197Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)
  8. 1587215Domain d4jasb_: 4jas B: [252853]
    Other proteins in same PDB: d4jasa1, d4jasa2
    automated match to d3dgec_
    complexed with adp, mg; mutant

Details for d4jasb_

PDB Entry: 4jas (more details), 3 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E and RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d4jasb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jasb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln
e

SCOPe Domain Coordinates for d4jasb_:

Click to download the PDB-style file with coordinates for d4jasb_.
(The format of our PDB-style files is described here.)

Timeline for d4jasb_: