Class a: All alpha proteins [46456] (285 folds) |
Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) |
Family a.30.2.0: automated matches [227712] (1 protein) not a true family |
Protein automated matches [227713] (2 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [227714] (3 PDB entries) |
Domain d4jasa1: 4jas A:244-320 [252851] Other proteins in same PDB: d4jasa2, d4jasb_ automated match to d2c2aa1 complexed with adp, mg; mutant |
PDB Entry: 4jas (more details), 3 Å
SCOPe Domain Sequences for d4jasa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jasa1 a.30.2.0 (A:244-320) automated matches {Thermotoga maritima [TaxId: 243274]} lkridrmktefianishelrtpltvikgyaemiynslgeldlstlkefletiieqsnhle nllnelldfsrlerksl
Timeline for d4jasa1: