Lineage for d4j9fe_ (4j9f E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2053715Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2054094Protein automated matches [190043] (6 species)
    not a true protein
  7. 2054118Species Human (Homo sapiens) [TaxId:9606] [187799] (30 PDB entries)
  8. 2054121Domain d4j9fe_: 4j9f E: [252846]
    automated match to d4jjca_
    complexed with gol, so4

Details for d4j9fe_

PDB Entry: 4j9f (more details), 1.09 Å

PDB Description: Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
PDB Compounds: (E:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d4j9fe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j9fe_ b.34.2.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvns

SCOPe Domain Coordinates for d4j9fe_:

Click to download the PDB-style file with coordinates for d4j9fe_.
(The format of our PDB-style files is described here.)

Timeline for d4j9fe_: