Lineage for d4j71a_ (4j71 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673023Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 1673024Species Human (Homo sapiens) [TaxId:9606] [69824] (35 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 1673031Domain d4j71a_: 4j71 A: [252833]
    automated match to d1j1bb_
    complexed with 1jx, cl, so4

Details for d4j71a_

PDB Entry: 4j71 (more details), 2.31 Å

PDB Description: crystal structure of gsk3b in complex with inhibitor 1r
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d4j71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j71a_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar

SCOPe Domain Coordinates for d4j71a_:

Click to download the PDB-style file with coordinates for d4j71a_.
(The format of our PDB-style files is described here.)

Timeline for d4j71a_: