Lineage for d4j6ia4 (4j6i A:726-1087)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2222237Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)
  8. 2223107Domain d4j6ia4: 4j6i A:726-1087 [252818]
    Other proteins in same PDB: d4j6ia1, d4j6ia2, d4j6ia3, d4j6ia5
    automated match to d1e7ua4
    complexed with 1jv

Details for d4j6ia4

PDB Entry: 4j6i (more details), 2.9 Å

PDB Description: Discovery of thiazolobenzoxepin PI3-kinase inhibitors that spare the PI3-kinase beta isoform
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4j6ia4:

Sequence, based on SEQRES records: (download)

>d4j6ia4 d.144.1.0 (A:726-1087) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wf

Sequence, based on observed residues (ATOM records): (download)

>d4j6ia4 d.144.1.0 (A:726-1087) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghiervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwf

SCOPe Domain Coordinates for d4j6ia4:

Click to download the PDB-style file with coordinates for d4j6ia4.
(The format of our PDB-style files is described here.)

Timeline for d4j6ia4: