SCOPe 2.05: Domain d4j2va3: 4j2v A:388-583

Lineage for d4j2va3 (4j2v A:388-583)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (5 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [256129] (5 PDB entries)

8. Domain d4j2va3: 4j2v A:388-583 [252814]
   automated match to d4emxa3
   complexed with act, diu, fmt, mli

Details for d4j2va3

PDB Entry: 4j2v, 2.12 Å

PDB Description: crystal structure of equine serum albumin in complex with 3,5- diiodosalicylic acid

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4j2va3:

Sequence; same for both SEQRES and ATOM records:

>d4j2va3 a.126.1.0 (A:388-583) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kkncdlfeevgeydfqnalivrytkkapqvstptlveigrtlgkvgsrccklpeserlpc
senhlalalnrlcvlhektpvsekitkcctdslaerrpcfsaleldegyvpkefkaetft
fhadictlpedekqikkqsalaelvkhkpkatkeqlktvlgnfsafvakccgredkeacf
aeegpklvassqlala

Timeline for d4j2va3:

• d4j2va3 first appeared in SCOPe 2.04
  
• d4j2va3 appears in SCOPe 2.06
  
• d4j2va3 appears in the current release, SCOPe 2.08