Lineage for d4j2qa1 (4j2q A:10-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765812Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)
  6. 2765849Protein automated matches [227018] (1 species)
    not a true protein
  7. 2765850Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries)
  8. 2765853Domain d4j2qa1: 4j2q A:10-182 [252808]
    automated match to d1ayra1

Details for d4j2qa1

PDB Entry: 4j2q (more details), 3 Å

PDB Description: Crystal structure of C-terminally truncated arrestin reveals mechanism of arrestin activation
PDB Compounds: (A:) S-arrestin

SCOPe Domain Sequences for d4j2qa1:

Sequence, based on SEQRES records: (download)

>d4j2qa1 b.1.18.11 (A:10-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafrygq
edidvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcs
vmlqpapqdvgkscgvdfeikafathstdveedkipkkssvrllirkvqhapr

Sequence, based on observed residues (ATOM records): (download)

>d4j2qa1 b.1.18.11 (A:10-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hvifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafrygq
edidmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcsv
mlqpapqdvgkscgvdfeikafathkipkkssvrllirkvqhapr

SCOPe Domain Coordinates for d4j2qa1:

Click to download the PDB-style file with coordinates for d4j2qa1.
(The format of our PDB-style files is described here.)

Timeline for d4j2qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4j2qa2