Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (83 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [234364] (3 PDB entries) |
Domain d4j1ob1: 4j1o B:1-126 [252800] Other proteins in same PDB: d4j1oa2, d4j1ob2 automated match to d4e8ga1 complexed with gol, iod, mg, pbe |
PDB Entry: 4j1o (more details), 1.6 Å
SCOPe Domain Sequences for d4j1ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1ob1 d.54.1.0 (B:1-126) automated matches {Paracoccus denitrificans [TaxId: 318586]} mkiaeihvyahdlpvkdgpytiasstvwslqttlvkivadsglagwgetcpvgptyapsh algaraalaemapgliganplqplvlrrrmdgllcghnyakaaidiaaydlmgkhygvrv adllgg
Timeline for d4j1ob1: