Lineage for d4j0qe3 (4j0q E:305-397)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544858Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1544859Protein automated matches [254425] (11 species)
    not a true protein
  7. 1544879Species Pseudomonas putida [TaxId:160488] [256313] (2 PDB entries)
  8. 1544884Domain d4j0qe3: 4j0q E:305-397 [252795]
    Other proteins in same PDB: d4j0qa1, d4j0qa2, d4j0qb1, d4j0qb2, d4j0qc1, d4j0qc2, d4j0qd1, d4j0qd2, d4j0qe1, d4j0qe2
    automated match to d1b23p2
    complexed with gdp, mes, mg, mpd

Details for d4j0qe3

PDB Entry: 4j0q (more details), 2.29 Å

PDB Description: crystal structure of pseudomonas putida elongation factor tu (ef-tu)
PDB Compounds: (E:) elongation factor tu-a

SCOPe Domain Sequences for d4j0qe3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j0qe3 b.44.1.0 (E:305-397) automated matches {Pseudomonas putida [TaxId: 160488]}
htkftaevyvlskeeggrhtpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtv
tliktiamedglrfaireggrtvgagvvakiie

SCOPe Domain Coordinates for d4j0qe3:

Click to download the PDB-style file with coordinates for d4j0qe3.
(The format of our PDB-style files is described here.)

Timeline for d4j0qe3: