Lineage for d4j0qe2 (4j0q E:206-304)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792093Species Pseudomonas putida [TaxId:160488] [256312] (2 PDB entries)
  8. 1792098Domain d4j0qe2: 4j0q E:206-304 [252794]
    Other proteins in same PDB: d4j0qa1, d4j0qa3, d4j0qb1, d4j0qb3, d4j0qc1, d4j0qc3, d4j0qd1, d4j0qd3, d4j0qe1, d4j0qe3
    automated match to d1b23p1
    complexed with gdp, mes, mg, mpd

Details for d4j0qe2

PDB Entry: 4j0q (more details), 2.29 Å

PDB Description: crystal structure of pseudomonas putida elongation factor tu (ef-tu)
PDB Compounds: (E:) elongation factor tu-a

SCOPe Domain Sequences for d4j0qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j0qe2 b.43.3.0 (E:206-304) automated matches {Pseudomonas putida [TaxId: 160488]}
pvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemf
rklldegragencgvllrgtkrddvergqvlvkpgsvkp

SCOPe Domain Coordinates for d4j0qe2:

Click to download the PDB-style file with coordinates for d4j0qe2.
(The format of our PDB-style files is described here.)

Timeline for d4j0qe2: