Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (71 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [234379] (3 PDB entries) |
Domain d4izgb2: 4izg B:127-369 [252771] Other proteins in same PDB: d4izga1, d4izgb1 automated match to d4e8ga2 complexed with 4op, iod, mg |
PDB Entry: 4izg (more details), 1.7 Å
SCOPe Domain Sequences for d4izgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4izgb2 c.1.11.0 (B:127-369) automated matches {Paracoccus denitrificans [TaxId: 318586]} vaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwerirg tgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyldesge dlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiiaaact higatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfgppva sfs
Timeline for d4izgb2: