SCOPe 2.05: Domain d4iw3k1: 4iw3 K:10-205

Lineage for d4iw3k1 (4iw3 K:10-205)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [256311] (2 PDB entries)

8. Domain d4iw3k1: 4iw3 K:10-205 [252735]
   Other proteins in same PDB: d4iw3a_, d4iw3b2, d4iw3b3, d4iw3j_, d4iw3k2, d4iw3k3
   automated match to d1b23p3
   complexed with gdp, mg, mn, oga

Details for d4iw3k1

PDB Entry: 4iw3, 2.7 Å

PDB Description: crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) in complex with elongation factor tu (ef-tu)

PDB Compounds: (K:) elongation factor tu-a

SCOPe Domain Sequences for d4iw3k1:

Sequence, based on SEQRES records:

>d4iw3k1 c.37.1.0 (K:10-205) automated matches {Pseudomonas putida [TaxId: 160488]}
lphvnvgtighvdhgkttltaaltrvcsevfgsaivefdkidsapeekargitintahve
ynstirhyahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvp
yivvflnkadlvddaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgt
tavkklvetldsyipe

Sequence, based on observed residues (ATOM records):

>d4iw3k1 c.37.1.0 (K:10-205) automated matches {Pseudomonas putida [TaxId: 160488]}
lphvnvgtighvdhgkttltaaltrvcsevfgkidsapeekagitintahveynstirhy
ahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnk
adlvaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetl
dsyipe

Timeline for d4iw3k1:

• d4iw3k1 first appeared in SCOPe 2.04
  
• d4iw3k1 appears in SCOPe 2.06
  
• d4iw3k1 appears in the current release, SCOPe 2.08