![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (24 species) not a true protein |
![]() | Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (1 PDB entry) |
![]() | Domain d4iuga4: 4iug A:664-845 [252723] Other proteins in same PDB: d4iuga1, d4iuga2, d4iuga3 automated match to d1tg7a2 complexed with cd, gal, m6d, nag |
PDB Entry: 4iug (more details), 2.6 Å
SCOPe Domain Sequences for d4iuga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iuga4 b.18.1.0 (A:664-845) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} apeiklpglkdldwkyldtlpeikssyddsawvsadlpktknthrpldtptslyssdygf htgyliyrghfvangkeseffirtqggsafgssvwlnetylgswtgadyamdgnstykls qlesgknyvitvvidnlgldenwtvgeetmknprgilsyklsgqdasaitwkltgnlgge dy
Timeline for d4iuga4:
![]() Domains from same chain: (mouse over for more information) d4iuga1, d4iuga2, d4iuga3, d4iuga5 |