Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (72 species) not a true protein |
Species Fungus (Aspergillus oryzae) [TaxId:5062] [256307] (1 PDB entry) |
Domain d4iuga1: 4iug A:40-393 [252720] Other proteins in same PDB: d4iuga2, d4iuga3, d4iuga4, d4iuga5 automated match to d1tg7a5 complexed with cd, gal, m6d, nag |
PDB Entry: 4iug (more details), 2.6 Å
SCOPe Domain Sequences for d4iuga1:
Sequence, based on SEQRES records: (download)
>d4iuga1 c.1.8.0 (A:40-393) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} dllqdivtwddkslfingerimlfsgevhpfrlpvpslwldifhkiralgfncvsfyidw allegkpgdyraegifalepffdaakeagiyliarpgsyinaevsgggfpgwlqrvngtl rssdepflkatdnyianaaaavakaqitnggpvilyqpeneysggccgvkypdadymqyv mdqarkadivvpfisndaspsghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpd nfrtlhleqspstpysllefqagafdpwggpgfekcyalvnhefsrvfyrndlsfgvstf nlymtfggtnwgnlghpggytsydygspitetrnvtrekysdikllanfvkasp
>d4iuga1 c.1.8.0 (A:40-393) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]} dllqdivtwddkslfingerimlfsgevhpfrlpvpslwldifhkiralgfncvsfyidw allegkpgdyraegifalepffdaakeagiyliarpgsyinaevsgggfpgwlqrvngtl rssdepflkatdnyianaaaavakaqitnggpvilyqpeneysdadymqyvmdqarkadi vvpfisndaspsghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpdnfrtlhleq spstpysllefqagafdpwggpgfekcyalvnhefsrvfyrndlsfgvstfnlymtfggt nwgnlghpggytsydygspitetrnvtrekysdikllanfvkasp
Timeline for d4iuga1:
View in 3D Domains from same chain: (mouse over for more information) d4iuga2, d4iuga3, d4iuga4, d4iuga5 |