Lineage for d1bdxa3 (1bdx A:1-64)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1788737Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
    automatically mapped to Pfam PF01330
  6. 1788738Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 1788739Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 1788745Domain d1bdxa3: 1bdx A:1-64 [25270]
    Other proteins in same PDB: d1bdxa1, d1bdxa2, d1bdxb1, d1bdxb2, d1bdxc1, d1bdxc2, d1bdxd1, d1bdxd2
    protein/DNA complex

Details for d1bdxa3

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1bdxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxa3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOPe Domain Coordinates for d1bdxa3:

Click to download the PDB-style file with coordinates for d1bdxa3.
(The format of our PDB-style files is described here.)

Timeline for d1bdxa3: