Lineage for d4irjd2 (4irj D:113-240)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521071Domain d4irjd2: 4irj D:113-240 [252690]
    Other proteins in same PDB: d4irja1, d4irjb_, d4irjc2
    automated match to d3q5ya2
    complexed with 1l9, nag

Details for d4irjd2

PDB Entry: 4irj (more details), 3 Å

PDB Description: structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex
PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irjd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4irjd2:

Click to download the PDB-style file with coordinates for d4irjd2.
(The format of our PDB-style files is described here.)

Timeline for d4irjd2: