SCOPe 2.04: Domain d4irjc1: 4irj C:2-115

Lineage for d4irjc1 (4irj C:2-115)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4irjc1: 4irj C:2-115 [252687]
   Other proteins in same PDB: d4irja1, d4irjb_, d4irjc2
   automated match to d2pyfa1
   complexed with 1l9, nag

Details for d4irjc1

PDB Entry: 4irj, 3 Å

PDB Description: structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irjc1:

Sequence; same for both SEQRES and ATOM records:

>d4irjc1 b.1.1.0 (C:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d4irjc1:

• d4irjc1 is new in SCOPe 2.04-stable
  
• d4irjc1 appears in SCOPe 2.05
  
• d4irjc1 appears in the current release, SCOPe 2.08