SCOPe 2.05: Domain d4irja2: 4irj A:186-279

Lineage for d4irja2 (4irj A:186-279)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d4irja2: 4irj A:186-279 [252685]
   Other proteins in same PDB: d4irja1, d4irjb_, d4irjc2
   automated match to d3hujc2
   complexed with 1l9, nag

Details for d4irja2

PDB Entry: 4irj, 3 Å

PDB Description: structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4irja2:

Sequence, based on SEQRES records:

>d4irja2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d4irja2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

Timeline for d4irja2:

• d4irja2 first appeared in SCOPe 2.04
  
• d4irja2 appears in SCOPe 2.06
  
• d4irja2 appears in the current release, SCOPe 2.08