SCOPe 2.04: Domain d4irja1: 4irj A:7-185

Lineage for d4irja1 (4irj A:7-185)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries)

8. Domain d4irja1: 4irj A:7-185 [252684]
   Other proteins in same PDB: d4irja2, d4irjb_, d4irjc1, d4irjc2, d4irjd1, d4irjd2
   automated match to d3hujc1
   complexed with 1l9, nag

Details for d4irja1

PDB Entry: 4irj, 3 Å

PDB Description: structure of the mouse cd1d-4clphc-alpha-galcer-inkt tcr complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d4irja1:

Sequence; same for both SEQRES and ATOM records:

>d4irja1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d4irja1:

• d4irja1 is new in SCOPe 2.04-stable
  
• d4irja1 appears in SCOPe 2.05
  
• d4irja1 appears in the current release, SCOPe 2.08